warning JEEP GRAND WAGONEER 2022 User Guide

Page 95 of 428

WARNING!
Be sure the hood is fully latched before driving
your vehicle. If the hood is not fully latched, it
could open when the vehicle is in motion and
block your vision. Failure to follow this warning
could result in serious injury or death.
2

22_WS_OM_EN_USC_t.book Page 93

Page 98 of 428

:$51,1*
Driving with the liftgate open can allow
poisonous exhaust gases into your vehicle.
You and your passengers could be injured by
these fumes. Keep the liftgate closed when
you are operating the vehicle.
If you are required to drive with the liftgate
open, make sure that all windows are closed,
and the climate control blower switch is set at
high speed. Do not use the recirculation
mode.
WARNING!
During power operation, personal injury or cargo
damage may occur. Ensure the liftgate travel
path is clear. Make sure the liftgate is closed
and latched before driving away.

Page 99 of 428


WARNING!
Cargo tie-downs are not safe anchors for a
child seat tether strap. In a sudden stop or
accident, a tie-down could pull loose and allow
the child seat to come loose. A child could be
badly injured. Use only the anchors provided
for child seat tethers.
WARNING!
2

22_WS_OM_EN_USC_t.book Page 97

Page 100 of 428


WARNING!
In a collision, a loose cargo cover in the vehicle
could cause injury. It could fly around in a
sudden stop and strike someone in the vehicle.
Do not store the cargo cover on the cargo floor
or in the passenger compartment. Remove the
cover from the vehicle when taken from its
mounting. Do not store it in the vehicle.

Page 130 of 428

:$51,1*
Before exiting a vehicle, always come to a
complete stop, then shift the automatic trans-
mission into PARK and apply the parking
brake.
Always make sure the keyless ignition node is
in the OFF position, key fob is removed from
the vehicle and vehicle is locked.
Never leave children alone in a vehicle, or with
access to an unlocked vehicle. Leaving chil -
dren in a vehicle unattended is dangerous for
a number of reasons. A child or others could
be seriously or fatally injured. Children should
be warned not to touch the parking brake,
brake pedal or the gear selector.
WARNING!CAUTION!
Damage to the transmission may occur if the
following precautions are not observed:
Do not shift from REVERSE (Ryf3$5.RU
NEUTRAL into any forward gear when the
engine is above idle speed.
Shift into PARK only after the vehicle has
come to a complete stop.
Shift into or out of REVERSE only after the
vehicle has come to a complete stop and the
engine is at idle speed.
Before shifting into any gear, make sure your
foot is firmly on the brake pedal.

Page 132 of 428

WKDW\RXUYHKLFOHLVLQ
3$5.E\ORRNLQJIRUWKH3LQWKHLQVWUXPHQW
FOXVWHUGLVSOD\DQGRQWKHJHDUVHOHFWRU$VDQ
DGGHGSUHFDXWLRQDOZD\VDSSO\WKHSDUNLQJEUDNH
ZKHQH[LWLQJWKHYHKLFOH
AutoPark is a supplemental feature. It is not
designed to replace the need to shift your
vehicle into PARK. It is a back up system and
should not be relied upon as the primary
method by which the driver shifts the vehicle
into PARK.
WARNING!WARNING!

If vehicle speed is above 1.2 mph (1.9 km/hyf
the transmission will default to NEUTRAL until
the vehicle speed drops below 1.2 mph
(1.9 km/hyf$YHKLFOHOHIWLQWKH1(875$/
position can roll. As an added precaution,
always apply the parking brake when exiting the
vehicle.

Page 133 of 428

:$51,1*
Never pour fuel or other flammable liquid into
the throttle body air inlet opening in an
attempt to start the vehicle. This could result
in flash fire causing serious personal injury.
Do not attempt to push or tow your vehicle to
get it started. Vehicles equipped with an auto-
matic transmission cannot be started this
way. Unburned fuel could enter the catalytic
converter and once the engine has started,
ignite and damage the converter and vehicle.
WARNING!
WARNING!
Remember to disconnect the engine block
heater cord before driving. Damage to the
110-115 Volt electrical cord could cause
electrocution.
4

22_WS_OM_EN_USC_t.book Page 131

Page 135 of 428

:$51,1*
Never use the PARK position as a substitute
for the parking brake. Always apply the
parking brake fully when parked to guard
against vehicle movement and possible injury
or damage.
When exiting the vehicle, always turn the igni-
tion off, secure the key fob, and lock your
vehicle.
WARNING!CAUTION!
If the Brake System Warning Light remains on
with the parking brake released, a brake system
malfunction is indicated. Have the brake system
serviced by an authorized dealer immediately.
WARNING!
Driving the vehicle with the parking brake
engaged, or repeated use of the parking brake
to slow the vehicle, may cause serious damage
to the brake system. Be sure the parking brake
is fully disengaged before driving; failure to do
so can lead to brake failure and a collision.
4

22_WS_OM_EN_USC_t.book Page 133

Page 137 of 428

:$51,1*
<RXFDQEHEDGO\LQMXUHGZRUNLQJRQRUDURXQGD
PRWRUYHKLFOH'RRQO\WKDWVHUYLFHZRUNIRU
ZKLFK\RXKDYHWKHNQRZOHGJHDQGWKHULJKW
HTXLSPHQW,I\RXKDYHDQ\GRXEWDERXW\RXU
DELOLW\WRSHUIRUPDVHUYLFHMREWDNH\RXUYHKLFOH
WRDFRPSHWHQWPHFKDQLF
:$51,1*
Never use the PARK (PyfSRVLWLRQDVDVXEVWi-
tute for the parking brake. Always apply the
parking brake fully when exiting the vehicle to
guard against vehicle movement and possible
injury or damage.
WARNING!
4

22_WS_OM_EN_USC_t.book Page 135

Page 153 of 428

:$51,1*

&UXLVH&RQWUROFDQEHGDQJHURXVZKHUHWKH
V\VWHPFDQQRWPDLQWDLQDFRQVWDQWVSHHG<RXU
YHKLFOHFRXOGJRWRRIDVWIRUWKHFRQGLWLRQVDQG
\RXFRXOGORVHFRQWURODQGKDYHDQDFFLGHQW'R
QRWXVH&UXLVH&RQWUROLQKHDY\WUDIILFRURQURDGV
WKDWDUHZLQGLQJLF\VQRZFRYHUHGRUVOLSSHU\

:$51,1*
Adaptive Cruise Control (ACCyfLVDFRQYe-
nience system. It is not a substitute for active
driver involvement. It is always the driver’s
responsibility to be attentive of road, traffic,
and weather conditions, vehicle speed,
distance to the vehicle ahead and, most
importantly, brake operation to ensure safe
operation of the vehicle under all road condi -
tions. Your complete attention is always
required while driving to maintain safe control
of your vehicle. Failure to follow these warn -
ings can result in a collision and death or
serious personal injury.
The ACC system:
Does not react to pedestrians, oncoming
vehicles, and stationary objects (e.g., a
stopped vehicle in a traffic jam or a
disabled vehicleyf.

Cannot take street, traffic, and weather
conditions into account, and may be
limited upon adverse sight distance
conditions.

Does not always fully recognize complex
driving conditions, which can result in
wrong or missing distance warnings.
4

22_WS_OM_EN_USC_t.book Page 151

Page:   < prev 1-10 11-20 21-30 31-40 41-50 51-60 ... 60 next >