engine JEEP WRANGLER RUBICON 2020 Owners Manual

:$51,1*
Do not start or run an engine in a closed
garage or confined area. Exhaust gas
contains Carbon Monoxide (COyfZKLFKLV
odorless and colorless. Carbon Monoxide is
poisonous and can cause serious injury or
death when inhaled.
WARNING! (Continued\f

CAUTION!

In cold weather, always turn off the wiper
switch and allow the wipers to return to the
park position before turning off the engine.
f the wiper switch is left on and the wipers
freeze to the windshield, damage to the wiper
motor may occur when the vehicle is restarted.

:$51,1*
7RDYRLGVHULRXVLQMXU\RUGHDWK

Do not insert any objects into the receptacles.

Do not touch with wet hands.
Close the lid when not in use.
If this outlet is mishandled, it may cause an
electric shock and failure.
CAUTION!
Many accessories that can be plugged in
draw power from the vehicle's battery, even
when not in use (i.e., cellular phones, etc.yf
Eventually, if plugged in long enough, the
vehicle's battery will discharge sufficiently
to degrade battery life and/or prevent the
engine from starting.
Accessories that draw higher power (i.e.,
coolers, vacuum cleaners, lights, etc.yfZLOl
degrade the battery even more quickly.
Only use these intermittently and with
greater caution.
After the use of high power draw accesso-
ries, or long periods of the vehicle not being
started (with accessories still plugged inyf,
the vehicle must be driven a sufficient
length of time to allow the alternator to
recharge the vehicle's battery.
Power outlets are designed for accessory
plugs only. Do not hang any type of acces -
sory or accessory bracket from the plug.
Improper use of the power outlet can cause
damage.
2

20_JL_OM_EN_USC_t.book Page 121

:$51,1*
When in “Partial Off” mode, the TCS func-
tionality of ESC, (except for the limited slip
feature described in the TCS sectionyfKDV
been disabled and the “ESC Off Indicator
Light” will be illuminated. When in “Partial
Off” mode, the engine power reduction
feature of TCS is disabled, and the
enhanced vehicle stability offered by the
ESC system is reduced.
Trailer Sway Control (TSCyfLVGLVDEOHGZKHQ
the ESC system is in the “Partial Off” mode.
WARNING!

In the ESC “Full Off” mode, the engine torque
reduction and stability features are disabled.
Therefore, enhanced vehicle stability offered
by the ESC system is unavailable. In an emer-
gency evasive maneuver, the ESC system will
not engage to assist in maintaining stability.
ESC “Full Off” mode is intended for
off-highway or off-road use only.

The Electronic Stability Control (ESCyf
cannot prevent the natural laws of physics
from acting on the vehicle, nor can it
increase the traction afforded by prevailing
road conditions. ESC cannot prevent all
accidents, including those resulting from
excessive speed in turns, driving on very
slippery surfaces, or hydroplaning. ESC also
cannot prevent collisions.

:$51,1*
Do not leave children or animals inside
parked vehicles in hot weather. Interior
heat build-up may cause serious injury or
death.
It is extremely dangerous to ride in a cargo
area, inside or outside of a vehicle. In a
collision, people riding in these areas are
more likely to be seriously injured or killed.
Do not allow people to ride in any area of
your vehicle that is not equipped with seats
and seat belts.
Be sure everyone in your vehicle is in a seat
and using a seat belt properly.
WARNING!

Exhaust gases can injure or kill. They contain
carbon monoxide (COyfZKLFKLVFRORUOHVVDQG
odorless. Breathing it can make you
unconscious and can eventually poison you.
To avoid breathing (COyfIROORZWKHVHVDIHW\
tips:

Do not run the engine in a closed garage or
in confined areas any longer than needed
to move your vehicle in or out of the area.
If you are required to drive with the trunk/
liftgate/rear doors open, make sure that all
windows are closed and the climate control
BLOWER switch is set at high speed.
DO NOT use the recirculation mode.

If it is necessary to sit in a parked vehicle
with the engine running, adjust your heating
or cooling controls to force outside air into
the vehicle. Set the blower at high speed.

4

20_JL_OM_EN_USC_t.book Page 207

WKDW\RXUYHKLFOH
LVLQ3$5.E\ORRNLQJIRUWKH3LQWKH
LQVWUXPHQWFOXVWHUGLVSOD\DQGRQWKHJHDU
VHOHFWRU$VDQDGGHGSUHFDXWLRQDOZD\VDSSO\
WKHSDUNLQJEUDNHZKHQH[LWLQJWKHYHKLFOH
Extreme Cold Weather (Below –22°F Or
−30°Cyf
To ensure reliable starting at these
temperatures, use of an externally powered
electric engine block heater (available from an
authorized dealeryfLVUHFRPPHQGHG.
If Engine Fails To Start
If the engine fails to start after you have
followed the "Normal Starting" or "Extreme Cold
Weather" procedure, and has not experienced
an extended park condition as identified in
"Extended Park Starting" procedure it may be
flooded. Push the accelerator pedal all the way
to the floor and hold it there. Crank the engine
for no more than 15 seconds. This should clear
any excess fuel in case the engine is flooded.
Leave the ignition key in the RUN position,
release the accelerator pedal and repeat the
“Normal Starting” procedure.
WARNING!
If vehicle speed is above 1.2 mph (2.0 km/hyf
the transmission will default to NEUTRAL until
the vehicle speed drops below 1.2 mph
(1.9 km/hyf$YHKLFOHOHIWLQWKH1(875$/
position can roll. As an added precaution,
always apply the parking brake when exiting
the vehicle.
WARNING!
Never pour fuel or other flammable liquid
into the throttle body air inlet opening in an
attempt to start the vehicle. This could
result in flash fire causing serious personal
injury.
Do not attempt to push or tow your vehicle
to get it started. Vehicles equipped with an
automatic transmission cannot be started
this way. Unburned fuel could enter the
catalytic converter and once the engine has
started, ignite and damage the converter
and vehicle.
5

20_JL_OM_EN_USC_t.book Page 213

:$51,1*
'RQRWGRZQVKLIWIRUDGGLWLRQDOHQJLQH
EUDNLQJRQDVOLSSHU\VXUIDFH7KHGULYH
ZKHHOVFRXOGORVHWKHLUJULSDQGWKHYHKLFOH
FRXOGVNLG
&$87,21
Skipping gears and downshifting into lower
gears at higher vehicle speeds can damage
the engine and clutch systems, Any attempt
to shift into lower gear with clutch pedal
depressed may result damage to the clutch
system. Shifting into lower gear and
releasing the clutch may result in engine
damage.

When descending a hill, be very careful to
downshift one gear at a time to prevent over-
speeding the engine which can cause engine
damage, and/or clutch damage, even if the
clutch pedal is pressed. If transfer case is in
low range the vehicle speeds to cause
engine and clutch damage are significantly
lower.

WARNING!
Do not downshift for additional engine
braking on a slippery surface. The drive
wheels could lose their grip and the vehicle
could skid, causing a collision or personal
injury.
WARNING!

Failure to engage a transfer case position
completely can cause transfer case damage or
loss of power and vehicle control. You could
have a collision. Do not drive the vehicle unless
the transfer case is fully engaged.

WARNING!

Drivers must be careful when backing up even
when using the ParkView Rear Back Up Camera.
Always check carefully behind your vehicle, and
be sure to check for pedestrians, animals, other
vehicles, obstructions, or blind spots before
backing up. You are responsible for the safety of
your surroundings and must continue to pay
attention while backing up. Failure to do so can
result in serious injury or death.

CAUTION!
To avoid vehicle damage, ParkView should
only be used as a parking aid. The ParkView
camera is unable to view every obstacle or
object in your drive path.
To avoid vehicle damage, the vehicle must
be driven slowly when using ParkView to be
able to stop in time when an obstacle is
seen. It is recommended that the driver
look frequently over his/her shoulder when
using ParkView.
WARNING!
Never have any smoking materials lit in or
near the vehicle when the fuel door is open
or the tank is being filled.
Never add fuel when the engine is running.
This is in violation of most state and federal
fire regulations and may cause the
“Malfunction Indicator Light” to turn on.
A fire may result if fuel is pumped into a
portable container that is inside of a
vehicle. You could be burned. Always place
fuel containers on the ground while filling.
5

20_JL_OM_EN_USC_t.book Page 263

:$51,1*
'ULYLQJDFURVVDQLQFOLQHLQFUHDVHVWKHULVNRI
DUROORYHUZKLFKPD\UHVXOWLQVHYHUHLQMXU\
:$51,1*
,IWKHHQJLQHVWDOOVRU\RXORVHKHDGZD\RU
FDQQRWPDNHLWWRWKHWRSRIDVWHHSKLOORU
JUDGHQHYHUDWWHPSWWRWXUQDURXQG7RGRVR
PD\UHVXOWLQWLSSLQJDQGUROOLQJWKHYHKLFOH
ZKLFKPD\UHVXOWLQVHYHUHLQMXU\$OZD\VEDFN
FDUHIXOO\VWUDLJKWGRZQDKLOOLQ5(9(56(
1HYHUEDFNGRZQDKLOOLQ1(875$/XVLQJRQO\
WKHYHKLFOHEUDNHV1HYHUGULYHGLDJRQDOO\
DFURVVDKLOODOZD\VGULYHVWUDLJKWXSRUGRZQ
&$87,21

Water ingestion into the axles, transmission,
transfer case, engine or vehicle interior can
occur if you drive too fast or through too deep
of water. Water can cause permanent
damage to engine, driveline or other vehicle
components, and your brakes will be less
effective once wet and/or muddy.

When driving through water, do not exceed
5 mph (8 km/hyf$OZD\VFKHFNZDWHUGHSWK
before entering as a precaution, and check
all fluids afterward. Driving through water
may cause damage that may not be
covered by the New Vehicle Limited
Warranty.