warning CHRYSLER 300 2015 2.G Owner's Manual

LANESENSE
The LaneSense system can be enabled and disabled with the LaneSense button, located on the
switch panel below the Uconnect® display.
• Push the LaneSense buttonto turn the system ON (LED turns off ).
The LaneSense system is operational at speeds above 37 mph (60 km/h) and below 112 mph(180 km/h). The LaneSense system uses a forward looking camera to detect lane markings andmeasure vehicle position within the lane boundaries.
When both lane markings are detected and the driver unintentionally drifts out of the lane (noturn signal applied), the LaneSense system provides a haptic warning in the form of torqueapplied to the steering wheel to prompt the driver to remain within the lane boundaries. If thedriver continues to unintentionally drift out of the lane, the LaneSense system provides a visualwarning through the Driver Information Display (DID) to prompt the driver to remain within thelane boundaries.
The driver may manually override the haptic warning by applying torque into the steering wheelat any time.
When only a single lane marking is detected and the driver unintentionally drifts across the lanemarking (no turn signal applied), the LaneSense system provides a visual warning through theDriver Information Display (DID) to prompt the driver to remain within the lane. When only asingle lane marking is detected, a haptic (torque) warning will not be provided.
Refer to your Owner's Manual on the DVD for further details.
NOTE:
When operating conditions have been met, the LaneSense system will monitor if the driver’shands are on the steering wheel and provides an audible warning to the driver when the driver’shands are not detected on the steering wheel. The system will cancel if the driver does not returntheir hands to the wheel.
PA R K V I E W ® R E A R B AC K- U P C A M E R A
Yo u c a n s e e a n o n - s c r e e n i m a g e o f t h e r e a r o f y o u r v e h i c l e w h e n e v e r t h e t r a n s m i s s i o n i s s h i f t e dinto REVERSE. The ParkView® Rear Back-Up Camera image will be displayed on the radiodisplay screen, located on the center stack of the instrument panel.
If the radio display screen appears foggy, clean the camera lens located on the rear of the vehicleabove the rear license plate.
Refer to “ParkView® Rear Back-Up Camera — If Equipped” in “Understanding The Features Of
Yo u r Ve h i c l e ” i n y o u r O w n e r ' s M a n u a l o n t h e D V D f o r f u r t h e r d e t a i l s .
WARNING!
Drivers must be careful when backing up; even when using the ParkView® Rear Back-Up
Camera. Always check carefully behind your vehicle, and be sure to check for pedestrians,
animals, other vehicles, obstructions, or blind spots before backing up. You must continue to
pay attention while backing up. Failure to do so can result in serious injury or death.
OPERATING YOUR VEHICLE
42

• If AutoStick is engaged while the transmission gear selector is in the SPORT position, manual
gear selection will be maintained until the gear selector is returned to DRIVE, or as described
below. The transmission will not upshift automatically at redline in this mode, nor will down-
shifts be obtained if the accelerator pedal is pressed to the floor.
•IneitherDRIVEorSPORTmode,thetransmissionwillautomaticallydownshiftasthevehicle
slows (to prevent engine lugging) and will display the current gear.
• The transmission will automatically downshift to first gear when coming to a stop. After a stop,
the driver should manually upshift (+) the transmission as the vehicle is accelerated.
• You can start out, from a stop, in first or second gear. Tapping (+) at a stop will allow starting in
second gear. Starting out in second gear can be helpful in snowy or icy conditions.
•Ifarequesteddownshiftwouldcausetheenginetoover-speed,thatshiftwillnotoccur.
•Thesystemwillignoreattemptstoupshiftattoolowofavehiclespeed.
•Holdingthe(-)paddledepressedwilldownshiftthetransmissiontothelowestgearpossibleat
the current speed.
• Transmission shifting will be more noticeable when AutoStick is engaged.
•Thesystemmayreverttoautomaticshiftmodeifafaultoroverheatconditionisdetected.
To d i s e n g a g e A u t o S t i c k m o d e , p r e s s a n d h o l d t h e ( + ) s h i f t p a d d l e u n t i l " D " o r " S " i s o n c e a g a i n
indicated in the instrument cluster. Shifting out of SPORT mode will also disable AutoStick. You
can shift in or out of AutoStick mode at any time without taking your foot off the accelerator
pedal.
WARNING!
Do not downshift for additional engine braking on a slippery surface. The drive wheels could
lose their grip and the vehicle could skid, causing a collision or personal injury.
OPERATING YOUR VEHICLE
45

MAX A/C
MAX A/C sets the control for maximum cooling performance.
• Press and release to toggle between MAX A/C and the prior settings. The button on the
touchscreen illuminates when MAX A/C is ON.
In MAX A/C, the blower level and mode position can be adjusted to desired user settings.
Pressing other settings will cause the MAX A/C operation to switch to the prior settings and the
MAX A/C indicator will turn off.
SYNC Temperature Button
•Pressthe“SYNC”buttononcetocontroldriverandpassengertemperaturessimultaneously.
• Press the “SYNC” button a second time to control the temperatures individually.
Air Recirculation
• Use Recirculation for maximum A/C operation.
• For window defogging, turn the Recirculation button off.
• If the Recirculation button is pushed while in the AUTO mode, the indicator light may flash
three times to indicate the cabin air is being controlled automatically. The Recirculation button
will be greyed out in these conditions.
Heated Mirrors
The mirrors are heated to melt frost or ice. This feature is activated whenever you turn on the rear
window defroster.
BLIND SPOT MONITORING
The Blind Spot Monitoring (BSM) system uses two radar-based sensors, located inside the rear
bumper fascia, to detect Highway licensable vehicles (automobiles, trucks, motorcycles etc.) that
enter the blind spot zones from the rear/front/side of the vehicle.
The Blind Spot Monitoring (BSM) system warning light, located in the outside mirrors, will
illuminate if a vehicle moves into a blind spot zone.
The BSM system can also be configured to sound an audible (chime) alert and mute the radio to
notify you of objects that have entered the detection zones.
Refer to “Blind Spot Monitoring” in “Understanding The Features Of Your Vehicle” in your
Owner's Manual on the DVD for further details.
OPERATING YOUR VEHICLE
48

Pinch Protection Feature
This feature will detect an obstruction in the opening of the sunroof during Express Close
operation. If an obstruction in the path of the sunroof is detected, the sunroof will automatically
retract. Remove the obstruction if this occurs. Next, push the switch forward and release to
Express Close.
NOTE:
If three consecutive sunroof close attempts result in P inch Protect reversals, the fourth close
attempt will be a Manual Close movement with Pinch Protect disabled.
WARNING!
•Donotletchildrenplaywiththesunroof.Neverleavechildrenunattendedinavehicle,or
with access to an unlocked vehicle. Do not leave the Key Fob in or near the vehicle, and do
not leave the ignition of a vehicle equipped with Keyless Enter-N-Go™ in the ACC or
ON/RUN mode. Occupants, particularly unattended children, can become entrapped by
the power sunroof while operating the power sunroof switch. Such entrapment may result
in serious injury or death.
• In a collision, there is a greater risk of being thrown from a vehicle with an open sunroof.
Yo u c o u l d a l s o b e s e v e r e l y i n j u r e d o r k i l l e d . A l w a y s f a s t e n y o u r s e a t b e l t p r o p e r l y a n d m a k e
sure all passengers are properly secured.
•Donotallowsmallchildrentooperatethesunroof.Neverallowyourfingers,otherbody
parts, or any object to project through the sunroof opening. Injury may result.
WIND BUFFETING
Wind buffeting can be described as a helicopter-type percussion sound. If buffeting occurs with
the rear windows open, adjust the front and rear windows together.
If buffeting occurs with the sunroof open, adjust the sunroof opening, or adjust any window. This
will minimize buffeting.
OPERATING YOUR VEHICLE
51

Uconnect® ACCESS
Uconnect® Access — If Equipped (Available On Uconnect® 8.4A/8.4AN
—U.S.ResidentsOnly)
WARNING!
ALWAYS drive safely with your hands on the steering wheel. You have full responsibility and
assume all risks related to the use of the Uconnect® features and applications in this vehicle.
Only use Uconnect® when it is safe to do so. Failure to do so may result in an accident involving
serious injury or death.
Uconnect® Access enhances your ownership and driving experience by connecting your vehicle
with a built-in cellular connection. With Uconnect® Access, you can:
• Place a call to a local 9-1-1 Operator for emergency assistance.
•Remotelylock/unlockyourdoorsandstartyourvehiclefromvirtuallyanywhere,usingthe
Uconnect® Access App from your smartphone. You can also do so by logging into Mopar
Owner Connect, or by calling Uconnect® Care. (Vehicle must be within the United States and
have network coverage).
•TurnyourvehicleintoaWiFiHotspotandconnectyourdevicestotheinternet.
•Receivetextoremailnotificationsifyourvehicle'stheftalarmgoesoff.
•Receivestolenvehicleassistance,usingGPStechnologytohelpauthoritieslocateyour
vehicle if it is stolen.
•Listentoyourtextmessagesorsendfree-formtextmessageswithyourvoicewhilekeeping
your hands on the wheel, using the Voice Texting feature. Requires a cell phone that supports
Bluetooth Message Access Profile (MAP).
•Searchforplacestoeat,shop,relaxandplaywithYelp®,usingyourvoiceoron-screenmenu.
Then navigate to them (navigation standard on Uconnect® 8.4AN, optional on Uconnect®
8.4A).
•GetoperatorassistanceusingtheASSISTbuttononyourinteriorrearviewmirror.
Before you drive, familiarize yourself with the easy-to-use Uconnect® Access.
1. The ASSIST and 9-1-1 buttons are located on your rearview mirror. The ASSIST button is used
for contacting Roadside Assistance, Vehicle Care and Uconnect® Care. The 9-1-1 button
connects you to emergency services.
NOTE:
Ve h i c l e s s o l d i n C a n a d a a n d M e x i c o D O N O T h a v e 9 - 1 - 1 C a l l s y s t e m c a p a b i l i t i e s . 9 - 1 - 1 o r
other emergency line operators in Canada and Mexico may not answer or respond to 9-1-1
system calls.
2. The Uconnect® “Apps” button on the menu bar at the bottom right corner of the radio
touchscreen. This is where you can begin your registration process, manage your Apps and
purchase WiFi on demand.
ELECTRONICS
55

Selling Your Vehicle
When you sell your vehicle, we recommend that you remove your Uconnect® Access Account
information from the vehicle. You can do this using the radio touchscreen in the vehicle or on the
Mopar Owner Connect website (moparownerconnect.com). Removing your account informa-
tion cancels your subscription and makes your vehicle factory-ready for a new owner/subscriber.
1. From your vehicle’s radio touchscreen, select “Uconnect® Store” from the Apps Menu.
2. Select “My Apps,” then “Settings.” Press “Remove Uconnect® Account.”
3. Enter your Uconnect® Security PIN, and select “Continue.”
For additional information on Uconnect®:
•U.S.residents-visitDriveUconnect.comorcall1-877-855-8400.
•CanadianResidents-visitDriveUconnect.caorcall,1-800-465-2001(English)or
1-800-387-9983 (French).
Built-In Features (Uconnect® 8.4A/8.4AN)
CAUTION!
•Ignoringtherearviewmirrorlightcouldmeanyoumaynothave9-1-1Callserviceif
needed. If the rearview mirror light is illuminated, have an authorized dealer service the
9-1-1 Call system immediately.
•TheOccupantRestraintController(ORC)turnsontheAirBagWarningLightonthe
instrument panel if a malfunction is detected in any part of the air bag system. If the Air
Bag Warning Light is illuminated, the air bag system may not be working properly and the
9-1-1 system may not be able to send a signal to a 9-1-1 operator. If the Air Bag Warning
Light is illuminated, have an authorized dealer service your vehicle immediately.
•Ifanyoneinthevehiclecouldbeindanger(e.g.,fireorsmokeisvisible,dangerousroad
conditions or location), do not wait for voice contact from a 9-1-1 operator. All occupants
should exit the vehicle immediately and move to a safe location.
•Donotaddanyaftermarketelectricalequipmenttothevehicle’selectricalsystem.This
may prevent your vehicle from sending a signal to initiate an emergency call. To avoid
interference that can cause the 9-1-1 Call system to fail, never add aftermarket equipment
(e.g., two-way mobile radio, CB radio, data recorder, etc.) to your vehicle’s electrical
system or modify the antennas on your vehicle. IF YOUR VEHICLE LOSES BATTERY
POWER FOR ANY REASON (INCLUDING DURING OR AFTER AN ACCI-
DENT), THE UCONNECT® FEATURES, APPS AND SERVICES, AMONG OTH-
ERS, WILL NOT OPERATE.
ELECTRONICS
61

WARNING!
•Yourmotorizeddoororgatewillopenandclosewhileyouareprogrammingtheuniversal
transceiver. Do not program the transceiver if people or pets are in the path of the door or
gate.
•Donotrunyourvehicleinaclosedgarageorconfinedareawhileprogrammingthe
transceiver. Exhaust gas from your vehicle contains Carbon Monoxide (CO) which is
odorless and colorless. Carbon Monoxide is poisonous when inhaled and can cause you
and others to be severely injured or killed.
POWER OUTLETS
There are two 12 Volt electrical outlets on this vehicle.
The front 12 Volt power outlet has power available only when the ignition is placed in the ACC or
RUN position.
The center console outlet is powered directly from the battery (power available at all times).
Items plugged into this outlet may discharge the battery and/or prevent the engine from starting.
NOTE:
• Do not exceed the maximum power of
160 Watts (13 Amps) at 12 Volts. If the
160 Watt (13 Amp) power rating is ex-
ceeded, the fuse protecting the system will
need to be replaced.
• Power outlets are designed for accessory
plugs only. Do not insert any other object in
the power outlet as this will damage the
outlet and blow the fuse. Improper use of
the power outlet can cause damage not cov-
ered by your new vehicle warranty.
Front Power Outlet
Center Console Power Outlet
ELECTRONICS
123

ROADSIDE ASSISTANCE
Dial toll-free 1-800-521-2779 for U.S. Residents or 1-800-363-4869 for Canadian Residents.
•Provideyourname,vehicleidentificationnumber,licenseplatenumber,andyourlocation,
including the telephone number from which you are calling.
• Briefly describe the nature of the problem and answer a few simple questions.
•Youwillbegiventhenameoftheserviceproviderandanestimatedtimeofarrival.Ifyoufeel
you are in an “unsafe situation”, please let us know. With your consent, we will contact local
police or safety authorities.
INSTRUMENT CLUSTER WARNING LIGHTS
–ElectronicStabilityControl(ESC)Activation/Malfunction
Indicator Light
The “ESC Activation/Malfunction Indicator Light” in the instrument cluster will come on when
the ignition switch is turned to the ON/RUN position. It should go out with the engine running.
If the “ESC Activation/Malfunction Indicator Light” comes on continuously with the engine
running, a malfunction has been detected in the ESC system.
If this light remains on after several ignition cycles,andthevehiclehasbeendrivenseveralmiles
(kilometers) at speeds greater than 30 mph (48 km/h), we recommend you drive to the nearest
service center and have the vehicle serviced immediately.
–TirePressureMonitoringSystem(TPMS)Light
Each tire, including the spare (if provided), should be checked monthly when cold and inflated to
the inflation pressure recommended by the vehicle manufacturer on the vehicle placard or tire
inflation pressure label. (If your vehicle has tires of a different size than the size indicated on the
vehicle placard or tire inflation pressure label, you should determine the proper tire inflation
pressure for those tires).
As an added safety feature, your vehicle has been equipped with a tire pressure monitoring
system (TPMS) that illuminates a low tire pressure telltale when one or more of your tires is
significantly under-inflated. Accordingly, when the low tire pressure telltale illuminates, you
should stop and check your tires as soon as possible and inflate them to the proper pressure.
Driving on a significantly under-inflated tire causes the tire to overheat and can lead to tire failure.
Under-inflation also reduces fuel efficiency and tire tread life and may affect the vehicle’s
handling and stopping ability.
IF THE LIGHT STARTS FLASHING INDICATING A LOW TIRE PRESSURE, ADJUST
THE AIR PRESSURE IN THE LOW TIRE TO THE AIR PRESSURE SHOWN ON THE
VEHICLE PLACARD OR TIRE INFLATION PRESSURE LABEL LOCATED ON THE
DRIVER'S DOOR.
WHAT TO DO IN EMERGENCIES
126

NOTE:
AFTER INFLATION, THE VEHICLE MAY NEED TO BE DRIVEN FOR 20 MINUTES
BEFORE THE FLASHING LIGHT WILL TURN OFF.
Please note that the TPMS is not a substitute for proper tire maintenance, and it is the driver’s
responsibility to maintain correct tire pressure, even if under-inflation has not reached the level to
trigger illumination of the TPMS low tire pressure telltale.
Yo u r v e h i c l e h a s a l s o b e e n e q u i p p e d w i t h a T P M S m a l f u n c t i o n i n d i c a t o r t o i n d i c a t e w h e n t h e
system is not operating properly. The TPMS malfunction indicator is combined with the low tire
pressure telltale.
When the system detects a malfunction, the telltale will flash for approximately one minute and
then remain continuously illuminated. This sequence will continue upon subsequent vehicle
start-ups as long as the malfunction exists. When the malfunction indicator is illuminated, the
system may not be able to detect or signal low tire pressure as intended. TPMS malfunctions may
occur for a variety of reasons, including the installation of replacement or alternate tires or wheels
on the vehicle that prevent the TPMS from functioning properly. Always check the TPMS
malfunction telltale after replacing one or more tires or wheels on your vehicle to ensure that the
replacement or alternate tires and wheels allow the TPMS to continue to function properly.
NOTE:
Tire pressures change by approximately 1 psi (7 kPa) per 12° F (7° C) of air temperature change.
Keep this in mind when checking tire pressure inside a garage, especially in the Winter. Example:
If garage temperature is 68°F (20°C), and the outside temperature is 32°F (0°C), then the cold
tire inflation pressure should be increased by 3 psi (21 kPa), which equals 1 psi (7 kPa) for every
12°F (7°C) for this outside temperature condition.
CAUTION!
The TPMS has been optimized for the original equipment tires and wheels. TPMS pressures
and warning have been established for the tire size equipped on your vehicle. Undesirable
system operation or sensor damage may result when using replacement equipment that is not
of the same size, type, and/or style. Aftermarket wheels can cause sensor damage. Do not use
tire sealant from a can, or balance beads if your vehicle is equipped with a TPMS, as damage
to the sensors may result.
–EngineTemperatureWarningLight
This light warns of an overheated engine condition.
If the light turns on or flashes continuously while driving, safely pull over and stop the vehicle. If
the A/C system is on, turn it off. Also, shift the transmission into NEUTRAL and idle the vehicle.
If the temperature reading does not return to normal, turn the engine off immediately.
We r e c o m m e n d t h a t y o u d o n o t o p e r a t e t h e v e h i c l e o r e n g i n e d a m a g e w i l l o c c u r. H a v e t h e
vehicle serviced immediately.
WHAT TO DO IN EMERGENCIES
127

WARNING!
Ahotenginecoolingsystemisdangerous.Youorotherscouldbebadlyburnedbysteamor
boiling coolant.
–BrakeWarningLight
This light monitors various brake functions, including brake fluid level and parking brake appli-
cation. If the brake light turns on, it may indicate that the parking brake is applied, that the brake
fluid level is low, or that there is a problem with the anti-lock brake system reservoir.
If the light remains on when the parking brake has been disengaged, and the fluid level is at the
full mark on the master cylinder reservoir, it indicates a possible brake hydraulic system malfunc-
tion or that a problem with the Brake Booster has been detected by the Anti-Lock Brake System
(ABS)/Electronic Stability Control (ESC) system. In this case, the light will remain on until the
condition has been corrected. If the problem is related to the brake booster, the ABS pump will
run when applying the brake, and a brake pedal pulsation may be felt during each stop.
The dual brake system provides a reserve braking capacity in the event of a failure to a portion of
the hydraulic system. A leak in either half of the dual brake system is indicated by the Brake
Wa r n i n g L i g h t , w h i c h w i l l t u r n o n w h e n t h e b r a k e f l u i d l e v e l i n t h e m a s t e r c y l i n d e r h a s d r o p p e d
below a specified level. The light will remain on until the cause is corrected.
Ve h i c l e s e q u i p p e d w i t h t h e A n t i - L o c k B r a k e S y s t e m ( A B S ) a r e a l s o e q u i p p e d w i t h E l e c t r o n i c
Brake Force Distribution (EBD). In the event of an EBD failure, the Brake Warning Light will turn
on along with the ABS Light. Immediate repair to the ABS system is required.
Operation of the Brake Warning Light can be checked by turning the ignition switch from the
OFF position to the ON/RUN position. The light should illuminate for approximately two
seconds. The light should then turn off unless the parking brake is applied or a brake fault is
detected. If the light does not illuminate, have the light inspected by an authorized dealer.
The light also will turn on when the parking brake is applied with the ignition switch in the
ON/RUN position.
NOTE:
This light shows only that the parking brake is applied. It does not show the degree of brake
application.
WARNING!
Driving a vehicle with the red brake light on is dangerous. Part of the brake system may have
failed. It will take longer to stop the vehicle. You could have a collision. Have the vehicle
checked immediately.
Malfunction Indicator Light (MIL)
Certain conditions, such as a poor fuel quality, etc., may illuminate the MIL after engine start. The
vehicle should be serviced if the light stays on through several typical driving cycles. In most
situations, the vehicle will drive normally and not require towing.
WHAT TO DO IN EMERGENCIES
128